PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004363.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 213aa    MW: 22635.2 Da    PI: 9.7402
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004363.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.42.1e-403796261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +++al+cprCdstntkfCyynnys++qPryfCkaCrryWtkGG+lrnvPvGgg+rknk++
  Do004363.1 37 QDQALNCPRCDSTNTKFCYYNNYSMTQPRYFCKACRRYWTKGGTLRNVPVGGGSRKNKQQ 96
                7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-273595IPR003851Zinc finger, Dof-type
PfamPF027011.8E-343895IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.054195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MVASPPGEEA AAAARNIKAK QAWQQQAAGE RKPRPQQDQA LNCPRCDSTN TKFCYYNNYS  60
MTQPRYFCKA CRRYWTKGGT LRNVPVGGGS RKNKQQRASA ASSAPPASSS SSSGSKKVNN  120
ITQQLMMMPT AVSATTTTAD FSNVLPVLMS TGGGFELPTS DHHQVSLPFV PLSLSSDPDG  180
GSGAAPLFMD MLRGGFLDSN GLAXAANESA IWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763889e-55AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843609e-55AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980592.13e-88PREDICTED: dof zinc finger protein PBF-like
SwissprotO244636e-57PBF_MAIZE; Dof zinc finger protein PBF
TrEMBLK3ZJC53e-88K3ZJC5_SETIT; Uncharacterized protein
STRINGSi026678m8e-88(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.17e-40Dof family protein